Roseiflexus castenholzii: Rcas_1270 Help Entry Rcas_1270         CDS       T00585                                  Name (GenBank) ATP synthase F0, C subunit   KO K02110   F-type H+-transporting ATPase subunit c Organism rca  Roseiflexus castenholzii Pathway rca00190   Oxidative phosphorylation rca01100   Metabolic pathways Module rca_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:rca00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Rcas_1270  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:rca00194]     Rcas_1270 Photosynthesis proteins [BR:rca00194]  Photosystem and electron transport system   F-type ATPase [OT]    Rcas_1270 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C MP_p6 Motif Other DBs NCBI-ProteinID:  ABU57367 UniProt:  A7NIR4 LinkDB All DBs Position complement(1640236..1640469) Genome browser AA seq 77 aa AA seqDB search MTDDGLRLIAAALAVGIGAVGPGVGIGVIFSGALQAMGRNPEAEGTLRTYMFLGFALVEA LFIFALVIALLIAFRIV NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgacggatgacggtctgcgacttatcgctgcggcgctcgcggtcggcataggcgctgtt ggacctggcgttggcatcggcgttatcttcagcggtgcgctgcaggcgatgggccgcaac cctgaagccgaggggaccctgcgcacatacatgttcctcggctttgcattggtcgaagcg ctgttcatctttgcgctggtgatcgcgctgttgatcgccttccgcattgtgtag

DBGET integrated database retrieval system