KEGG   Roseiflexus castenholzii: Rcas_2802
Entry
Rcas_2802         CDS       T00585                                 
Name
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K15582  oligopeptide transport system permease protein
Organism
rca  Roseiflexus castenholzii
Pathway
rca01501  beta-Lactam resistance
rca02010  ABC transporters
rca02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rca00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Rcas_2802
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Rcas_2802
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Rcas_2802
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rca02000]
    Rcas_2802
Transporters [BR:rca02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    Rcas_2802
SSDB
Motif
Pfam: BPD_transp_1 OppC_N
Other DBs
NCBI-ProteinID: ABU58873
UniProt: A7NMU9
LinkDB
Position
3623763..3624665
AA seq 300 aa
MSAIAAKDTVTGADPIISRPPSNLWRDAAIRFSKNKLAMGALIVVGILVFLGVFADVLAP
QPNFARPIDARKFPGEAGYILGTDDVGRDMLKRLIHGVRTSLIVGISVQAIALVIGATLG
LSAGFLGGWVDFFVMRIVELFTAIPQLLFALFLISIFGGGLFNVILAIALIGWVDICRLT
RAQLFSLREKEFIEAARAIGIPPFQIAWRHLLPNALTPLIIAVTLGIPTAIFTEAGLSFL
GLGINEPTASLGKMVGASFAYIRVYWHMGLLPTLLIALIMLSFSFVGDGLRDALDPRLRK
NT seq 903 nt   +upstreamnt  +downstreamnt
atgagtgcgattgcggccaaagataccgtcaccggcgccgatccgattatttcgcgccct
cccagtaatctctggcgcgacgccgccatccgcttctcgaagaacaaactggcgatgggg
gcgctgattgtggtcggaatactggtgttcctcggcgtgttcgccgatgttctggcgcca
cagccgaacttcgctcgtcctatcgatgcgcgcaagttccccggcgaagcggggtatatc
ctgggcaccgatgatgtcgggcgcgatatgctgaaacgcctgatccatggcgtgcgcaca
tcactgatcgtcggcatctcagtccaggcgattgcgctggtcattggggcgactctggga
ttgagcgcgggttttctggggggatgggtcgatttctttgtcatgcggattgtagagttg
ttcacggctatcccacaattgttgtttgccctgttcctgatctcgatctttggcggtggg
ttgttcaatgttattctggcgattgcgttgatcggatgggtcgatatttgccgtctcacc
cgcgcccaactcttctcgttgcgcgaaaaggagttcatcgaagcggcgcgcgccattggc
attccaccgttccagattgcatggcggcatctgcttccaaatgcgctcacacctctgatc
atcgccgtcacgcttggtattcccaccgccattttcaccgaagctggcctcagtttcctg
gggcttggcatcaatgaaccgaccgccagcctcggcaagatggtcggcgcgtcgtttgcg
tacatccgcgtctactggcacatgggtctgctccctacgctcctgatcgctctgattatg
ctcagtttctcgttcgttggcgacggtctgcgcgacgcgctcgacccgcggttgcggaag
tag

DBGET integrated database retrieval system