Rouxiella chamberiensis: O1V66_08060 Help Entry O1V66_08060       CDS       T08677                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rcb  Rouxiella chamberiensis Pathway rcb01100   Metabolic pathways rcb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rcb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     O1V66_08060    00074 Mycolic acid biosynthesis     O1V66_08060   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     O1V66_08060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WAT02514 LinkDB All DBs Position complement(1737825..1738094) Genome browser AA seq 89 aa AA seqDB search MATQQDILAVVLDIINDIKNTGFTPEIVDLDAFIGGELGVDSVEMLESWYEIEKRLHIKV NDSDKRGIYTLGDLVAKIEAQMPELAEKS NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggcgacacaacaagacattctggcggtggtgctcgacatcatcaatgacatcaagaac accggttttacccctgaaatcgtggatctcgacgcctttatcggcggcgaactgggcgtg gattcggtcgaaatgctcgagtcctggtacgaaatcgaaaagcgcctacatatcaaggtc aatgacagcgacaagcgcggaatttacacgctgggcgatctcgttgccaaaatcgaggcg cagatgcccgagcttgccgaaaagtcctga

DBGET integrated database retrieval system