Rhodospirillum centenum: RC1_0747 Help Entry RC1_0747          CDS       T00785                                  Name (GenBank) conserved domain protein   KO K02078   acyl carrier protein Organism rce  Rhodospirillum centenum Pathway rce01100   Metabolic pathways rce01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rce00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RC1_0747    00074 Mycolic acid biosynthesis     RC1_0747   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RC1_0747 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ACI98178 UniProt:  B6IRU2 LinkDB All DBs Position 788934..789185 Genome browser AA seq 83 aa AA seqDB search MNSDTDAIIEEIVRALGPNLTPGVVITPETNITRDLGLDSLAVMNFVMVLEDKFDVSIPL DKIAEVETVGDLARTINELRGGN NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaactccgataccgacgccatcattgaagagattgtccgtgccctcgggccaaacctg actccgggcgtcgtcataacccctgaaacgaacatcacccgcgatctggggctggattcg ctcgcggtgatgaacttcgtcatggttcttgaagacaagttcgacgtctcaatccctctc gacaagatcgcggaagtggaaaccgtgggcgatcttgcgagaaccatcaatgaactccgg ggcggcaactag

DBGET integrated database retrieval system