Rhodospirillum centenum: RC1_1031 Help Entry RC1_1031          CDS       T00785                                  Name (GenBank) conserved domain protein   KO K03116   sec-independent protein translocase protein TatA Organism rce  Rhodospirillum centenum Pathway rce03060   Protein export rce03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:rce00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     RC1_1031  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     RC1_1031  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:rce02044]     RC1_1031 Secretion system [BR:rce02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    RC1_1031 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ACI98454 UniProt:  B6ISL8 LinkDB All DBs Position 1094789..1095022 Genome browser AA seq 77 aa AA seqDB search MSIGIWQIVLILLIVLIIFGAGKLPKVMGDVAKGVRNFKSGLKDDSDDQGADEPKVLRSE TPVGTDATVKKDEAVKG NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtccatcggtatttggcagatcgtcctcatccttctgatcgtgttgatcatcttcggc gccggcaagctgcccaaggtgatgggggacgtcgccaagggtgtccggaacttcaagtcc ggcctcaaggatgacagcgacgatcagggggccgacgagcccaaggtcctccgctcggag acgccggtcgggaccgacgccaccgtgaagaaggacgaggcggtcaagggctga

DBGET integrated database retrieval system