Rhodospirillum centenum: RC1_1564
Help
Entry
RC1_1564 CDS
T00785
Name
(GenBank) predicted permease YjgP
KO
K11720
lipopolysaccharide export system permease protein
Organism
rce
Rhodospirillum centenum
Pathway
rce02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
rce00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
RC1_1564
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
rce02000
]
RC1_1564
Transporters [BR:
rce02000
]
ABC transporters, prokaryotic type
ABC-2 type and other transporters
Lipopolysaccharide transporter
RC1_1564
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
LptF_LptG
FtsX
Motif
Other DBs
NCBI-ProteinID:
ACI98967
UniProt:
B6IN70
LinkDB
All DBs
Position
complement(1611192..1612286)
Genome browser
AA seq
364 aa
AA seq
DB search
MRLSATLSLYIGRQFVLWFLAILGGMLAIVYLLDTVELLRRAANKPDAAFQIVLTMGLLK
LPEIGQEIVPFVVLFGGMYTFWRLTRTQELVVVRASGISVWQFMAPVLTATFLIGMTLVG
VLNPIFSAMLGRYEQLENRYLRGMKSSLDVAESGIWLRQVGEPQAYLIHADAIVPGTLEL
RQVMVLLNESDGQVSGRFDAASATLRDGFWELRDAWFNRPGRVGEFLPAYRLPTELTEQK
IQEAFASPDTLSFWELPGFIATLEATGLSSVRHRLHWHSLLAQPVLLCAMILLAAAFAMR
QVRRGGALTLIALGIAAALLLFVMQDIVLALGMSGTIPVLLAAWAPAGVSVMLGAAALLH
LEDG
NT seq
1095 nt
NT seq
+upstream
nt +downstream
nt
atgcgtctgtccgcgaccctttccctctacatcggccgtcagttcgtgctctggttcctg
gcgatcctgggcggcatgctggcgatcgtctacctgctggacacggtcgagctgctgcgc
cgtgccgcgaacaagccggatgcggccttccagatcgtgctgaccatgggcctgctgaag
ctgccggagatcgggcaggaaatcgtgcccttcgtcgtgctgttcggcggcatgtacacc
ttctggcgtctgacccggacgcaggagctggtggtggtgcgtgcctccggcatctccgtc
tggcagttcatggcgcccgtgctgacggccacgttcctgatcggcatgaccctggtcggg
gtgctgaacccgatcttctcggccatgctgggccgctacgagcagttggagaaccgctat
ctgcgcggcatgaaatcctcgctggacgtggcggaatccgggatctggctgcgtcaggtc
ggggagccccaggcctacctgatccatgccgatgcgatcgtgcccggcacgctggaactg
cggcaggtgatggtgttgctgaacgaaagcgacggacaggtgtccggccgtttcgacgct
gcctcggccaccctgcgcgatggcttctgggagttgcgcgacgcctggttcaaccggccc
ggccgggtgggggagttcctgcccgcctaccgcctgccgaccgagctgacggaacagaag
atccaggaagccttcgcctcgcccgacaccctgtccttctgggaactgccgggcttcatc
gccacgcttgaggcgacgggcctgtcctccgtccggcaccgcctgcactggcattcgctg
ctggcgcagccggtgctgctctgcgccatgatcctgctggccgcggccttcgccatgcgc
caggtccggcgcggcggcgcgctgacgctgatcgcgctgggcattgccgcggccctgctc
ctgttcgtgatgcaggacatcgtgctggccctcggcatgtccggcaccattccggtgctg
ctggcggcctgggccccggccggggtgagcgtcatgctgggggcggcggcactgttgcat
ctggaggacggatga
DBGET
integrated database retrieval system