Rhodospirillum centenum: RC1_1570 Help Entry RC1_1570          CDS       T00785                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rce  Rhodospirillum centenum Pathway rce01100   Metabolic pathways rce01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rce00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RC1_1570 (acpP)    00074 Mycolic acid biosynthesis     RC1_1570 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RC1_1570 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ACI98973 UniProt:  B6IN76 LinkDB All DBs Position complement(1618230..1618469) Genome browser AA seq 79 aa AA seqDB search MSDTAERVKKIVIEHLGVEESKVTESASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA EKILTVKDAIDFINQKTAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgataccgccgagcgcgtgaagaagatcgtcatcgagcacctgggcgtggaagag tccaaggtgacggagagcgccagcttcatcgacgatctgggtgcggactcgctcgacacc gtcgagctggtcatggccttcgaggaggagttcgggatcgagattccggacgatgcggcc gagaagatcctgaccgtgaaggacgcgatcgacttcatcaatcagaagaccgcggcctga

DBGET integrated database retrieval system