Rhodospirillum centenum: RC1_2393 Help Entry RC1_2393          CDS       T00785                                  Symbol hupB Name (GenBank) DNA-binding protein HupB   KO K03530   DNA-binding protein HU-beta Organism rce  Rhodospirillum centenum Brite KEGG Orthology (KO) [BR:rce00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:rce03032]     RC1_2393 (hupB)    03036 Chromosome and associated proteins [BR:rce03036]     RC1_2393 (hupB)    03400 DNA repair and recombination proteins [BR:rce03400]     RC1_2393 (hupB) DNA replication proteins [BR:rce03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     RC1_2393 (hupB) Chromosome and associated proteins [BR:rce03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     RC1_2393 (hupB) DNA repair and recombination proteins [BR:rce03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       RC1_2393 (hupB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 SIMPL DUF2267 HU-DNA_bdg TetR_C_20 Motif Other DBs NCBI-ProteinID:  ACI99778 UniProt:  B6IUF3 LinkDB All DBs Position 2469692..2469967 Genome browser AA seq 91 aa AA seqDB search MQKADLAEAVAQATGASKAAAAKTVDAIFDAIQQALAKGEDVRLTGFGTFSVSERAAREG RNPQTGATIQIAASKQPKFTAGKALKDAVNG NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgcagaaggctgatctcgccgaggccgtggcccaggcgaccggggccagcaaggcggcc gcggcgaagaccgtggatgccatcttcgacgccatccagcaggcgctcgccaagggcgag gatgtccggctgaccggtttcggcaccttctccgtctccgagcgcgccgcccgcgagggc cgcaacccgcagaccggcgcgaccatccagatcgccgcctccaagcagcccaagttcacg gccggcaaggccctgaaggacgcggtcaacggctga

DBGET integrated database retrieval system