Rhodospirillum centenum: RC1_4034 Help Entry RC1_4034          CDS       T00785                                  Symbol ybgT Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism rce  Rhodospirillum centenum Pathway rce00190   Oxidative phosphorylation rce01100   Metabolic pathways rce02020   Two-component system Module rce_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:rce00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     RC1_4034 (ybgT)  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     RC1_4034 (ybgT) Enzymes [BR:rce01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      RC1_4034 (ybgT) SSDB OrthologParalogGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ACJ01375 UniProt:  B6IYK1 LinkDB All DBs Position complement(4251456..4251578) Genome browser AA seq 40 aa AA seqDB search MWYFAWLLGLPLAVVFAVLNGLWFELREDAARGQPDPDAF NT seq 123 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcctggctcctcggcctgcccctggccgtcgtcttcgccgtgctgaac gggctctggttcgaactgcgggaggacgccgcccgcggccagcccgacccggacgctttc tag

DBGET integrated database retrieval system