Rosistilla carotiformis: Poly24_02620 Help Entry Poly24_02620      CDS       T09894                                  Symbol acpP_1 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism rcf  Rosistilla carotiformis Pathway rcf00998   Biosynthesis of various antibiotics rcf01100   Metabolic pathways rcf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rcf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Poly24_02620 (acpP_1)    00074 Mycolic acid biosynthesis     Poly24_02620 (acpP_1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Poly24_02620 (acpP_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 DUF1493 DUF5783 Ribosomal_L12_N WGG Motif Other DBs NCBI-ProteinID:  QDV66575 UniProt:  A0A518JLZ8 LinkDB All DBs Position complement(337139..337381) Genome browser AA seq 80 aa AA seqDB search MASIEERVIDIVAEQLGVDKEKITRDTSFVNDLGADSLDTVELVMELEEEFDINIPDDSA EKIQKVGEAIDYIEKEQAAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggcatcgattgaagaacgcgtgatcgacattgtcgcagagcaattgggcgtggacaaa gagaagatcacccgagatacctcgtttgtaaacgatctaggtgcggactccttggacacc gtcgaacttgtgatggaactggaagaagagttcgacatcaacattcccgacgattcggct gagaagatccaaaaggtcggcgaagcgatcgactacatcgaaaaggaacaggctgcttcg taa

DBGET integrated database retrieval system