Methanocella arvoryzae: RCIX627 Help Entry RCIX627           CDS       T00526                                  Symbol rps27ae Name (GenBank) 30S ribosomal protein S27AE   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism rci  Methanocella arvoryzae Pathway rci03010   Ribosome Brite KEGG Orthology (KO) [BR:rci00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     RCIX627 (rps27ae)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     RCIX627 (rps27ae)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:rci03011]     RCIX627 (rps27ae)    04121 Ubiquitin system [BR:rci04121]     RCIX627 (rps27ae)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rci04147]     RCIX627 (rps27ae) Ribosome [BR:rci03011]  Ribosomal proteins   Eukaryotes    Small subunit     RCIX627 (rps27ae)   Archaea     RCIX627 (rps27ae) Ubiquitin system [BR:rci04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    RCIX627 (rps27ae) Exosome [BR:rci04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    RCIX627 (rps27ae)   Exosomal proteins of colorectal cancer cells    RCIX627 (rps27ae) SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Cas12f1-like_TNB Ribosomal_L37e Zn_ribbon_RPAB4 Lar_restr_allev Zn_ribbon_Nudix IBR_1 MqsA_antitoxin Zn_ribbon_IS1595 Phage_gp86 Zn_ribbon_RPB9 Phage_Mu_gp6 DUF7575 zf_C2H2_LIN26-LIR3_2nd Zn_ribbon_13 zf-C2H2_FBX41 Motif Other DBs NCBI-ProteinID:  CAJ36030 UniProt:  Q0W6G3 LinkDB All DBs Position complement(2177889..2178023) Genome browser AA seq 44 aa AA seqDB search MYEVKDGKVSRKGQTCPRCGDGVFMAAHKDRVSCGKCGYTEYKK NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atgtacgaagtcaaggacggcaaagtcagccgcaagggccagacctgcccccgctgcggc gacggcgtcttcatggcagcccacaaggaccgcgtctcctgcggcaagtgcggctacacc gagtacaagaaataa

DBGET integrated database retrieval system