Rosa chinensis (China rose): 112169809 Help Entry 112169809         CDS       T06020                                  Name (RefSeq) SKP1-like protein 14   KO K03094   S-phase kinase-associated protein 1 Organism rcn  Rosa chinensis (China rose) Pathway rcn03083   Polycomb repressive complex rcn04120   Ubiquitin mediated proteolysis rcn04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:rcn00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     112169809    04120 Ubiquitin mediated proteolysis     112169809   09126 Chromosome    03083 Polycomb repressive complex     112169809  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rcn04131]     112169809    04121 Ubiquitin system [BR:rcn04121]     112169809    03036 Chromosome and associated proteins [BR:rcn03036]     112169809 Membrane trafficking [BR:rcn04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     112169809 Ubiquitin system [BR:rcn04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      112169809    Cul7 complex      112169809 Chromosome and associated proteins [BR:rcn03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      112169809   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      112169809 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  112169809 NCBI-ProteinID:  XP_024162634 LinkDB All DBs Position 1:complement(54276738..54277133) Genome browser AA seq 131 aa AA seqDB search MSNVVRLRSSNNEVFEAAECMIAMSKTIQTMLNRFQDDQVVILPLEQVDSKTLAMVREWC DNHVTKSTLKQYQFVEGLDIDVLLHLLITANYLDIKELGNHMREAIAERAQRKALEEIDP RSFHTAVFLKG NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atgtcaaatgttgtgagattgcggagctcgaacaacgaagtgttcgaagcagccgagtgc atgatagccatgtccaaaaccattcagacaatgctaaataggttccaagacgaccaagtg gtgatacttccactggaacaagtggattccaaaaccctagccatggtaagagagtggtgt gacaatcacgtcacgaagagcaccctaaaacagtaccaatttgtggagggactcgatata gacgttctcttgcatctcctgataactgcaaactatctggacatcaaggagttggggaat catatgcgcgaagcgattgcggagagggctcaaaggaaagcacttgaagagatcgatccc agaagttttcatactgcagtttttttgaaaggatga

DBGET integrated database retrieval system