Rosa chinensis (China rose): 112173783 Help Entry 112173783         CDS       T06020                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism rcn  Rosa chinensis (China rose) Pathway rcn03083   Polycomb repressive complex rcn04120   Ubiquitin mediated proteolysis rcn04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:rcn00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     112173783    04120 Ubiquitin mediated proteolysis     112173783   09126 Chromosome    03083 Polycomb repressive complex     112173783  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rcn04131]     112173783    04121 Ubiquitin system [BR:rcn04121]     112173783    03036 Chromosome and associated proteins [BR:rcn03036]     112173783 Membrane trafficking [BR:rcn04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     112173783 Ubiquitin system [BR:rcn04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      112173783    Cul7 complex      112173783 Chromosome and associated proteins [BR:rcn03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      112173783   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      112173783 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  112173783 NCBI-ProteinID:  XP_024167232 LinkDB All DBs Position 6:63167053..63168213 Genome browser AA seq 159 aa AA seqDB search MSSGRKITLKSSDGESFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYC KKHVDAAPKSDDRSSSSGDDELKNWDADFVKVDQATLFDLILAANYLNIKNLLDLTCQTV ADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atgtcgtccggaaggaagataacgctgaagagctccgacggcgagtcgttcgaggtggac gaggcggtggctttggaatcgcagaccatcaagcacatgatcgaggacgattgcgccgac aatgggatccctctccccaacgtcaccagcaagatcttggccaaggtcatcgagtactgc aagaagcacgtcgacgctgcgcctaagtccgacgaccgctcctcctcctccggcgacgat gagctcaagaactgggacgccgacttcgtcaaggtcgaccaggccaccctcttcgatctc atcctggctgcaaactatctcaacatcaagaacttgctcgaccttacttgccaaacggtg gcggacatgatcaaggggaaaacacctgaggagattcgcaagacattcaacatcaagaat gactttacaccagaggaagaggaggaggtccgcagggagaaccaatgggcttttgagtga

DBGET integrated database retrieval system