Rosa chinensis (China rose): 112173865 Help Entry 112173865         CDS       T06020                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism rcn  Rosa chinensis (China rose) Pathway rcn03083   Polycomb repressive complex rcn04120   Ubiquitin mediated proteolysis rcn04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:rcn00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     112173865    04120 Ubiquitin mediated proteolysis     112173865   09126 Chromosome    03083 Polycomb repressive complex     112173865  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rcn04131]     112173865    04121 Ubiquitin system [BR:rcn04121]     112173865    03036 Chromosome and associated proteins [BR:rcn03036]     112173865 Membrane trafficking [BR:rcn04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     112173865 Ubiquitin system [BR:rcn04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      112173865    Cul7 complex      112173865 Chromosome and associated proteins [BR:rcn03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      112173865   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      112173865 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Myb_DNA-binding DUF3140 Myb_DNA-binding_7 Motif Other DBs NCBI-GeneID:  112173865 NCBI-ProteinID:  XP_024167315 LinkDB All DBs Position 6:67237..68188 Genome browser AA seq 162 aa AA seqDB search MSTEIGNKKLTLTSCDGDDFQIREAVALESQTIKHMVEDGCADNAIPLPNVTGAILAKVI EYCKRHVEDKESKNEDNKNDQEESLKKFDADFVDVDQGVLFDLILAANYLNIKGLLDLTC QTVADMIKGKTPEQIREKFNIKNDFTPQEEEEVRRENAWAFD NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atgtcgactgaaattgggaacaagaagctaaccctgaccagctgcgacggagatgatttc cagattagagaggcggttgcccttgaatcgcagaccatcaagcacatggtggaggacggc tgcgccgataatgcgatccccttgcccaacgtcaccggcgccatcctagccaaggtcatc gagtactgcaagaggcacgttgaggacaaggaaagcaagaatgaagacaataagaatgat caggaggagtctctcaagaaattcgacgccgatttcgtggacgtcgaccagggcgtcctg ttcgatctgatattggcagcaaactatctgaacatcaaggggctgctggacttgacatgc cagactgtggcagacatgataaagggaaagactcccgaacaaattcgcgagaaattcaac atcaagaatgacttcactcctcaggaagaagaggaggttcgaagggagaacgcatgggct tttgactga

DBGET integrated database retrieval system