Rosa chinensis (China rose): 112176621 Help Entry 112176621         CDS       T06020                                  Name (RefSeq) rac-like GTP-binding protein 3   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism rcn  Rosa chinensis (China rose) Pathway rcn04145   Phagosome rcn04148   Efferocytosis rcn04620   Toll-like receptor signaling pathway rcn05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:rcn00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     112176621    04148 Efferocytosis     112176621  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112176621  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     112176621  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rcn04131]     112176621   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rcn04147]     112176621    04031 GTP-binding proteins [BR:rcn04031]     112176621 Membrane trafficking [BR:rcn04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     112176621  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     112176621   Macropinocytosis    Ras GTPases     112176621  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     112176621 Exosome [BR:rcn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112176621   Exosomal proteins of other body fluids (saliva and urine)    112176621   Exosomal proteins of colorectal cancer cells    112176621   Exosomal proteins of bladder cancer cells    112176621 GTP-binding proteins [BR:rcn04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     112176621 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA Motif Other DBs NCBI-GeneID:  112176621 NCBI-ProteinID:  XP_024170413 LinkDB All DBs Position 7:1748500..1752391 Genome browser AA seq 211 aa AA seqDB search MASSASKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYVPTVFDNFSANVVVESTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENILKKWIPELQHYAPGVPVVLAGT KLDLREDKHYLADHPGLVPVTSAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAAIRVVI KPPQKQKEKKKKPRRGCLVNIVCGRRLVCLK NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggcttcaagcgcttccaagttcatcaagtgtgtaacagttggagatggagctgtgggg aagacctgtatgctcatttgttacaccagtaacaagtttcccactgattatgttcccaca gtgtttgataacttcagcgcaaatgtggtggttgaatctacaacagtgaacttaggcctc tgggacacagctgggcaagaagattacaatcgcctaaggccattgagctacagaggtgca gatgtctttgtcctagctttctcattagttagccgtgccagctatgagaacatactgaaa aagtggatccctgaactgcagcattatgctcctggagttccagtagtacttgctggcacc aaactagatcttcgagaggataagcactatttggctgatcacccagggttggtacctgtt actagcgcacagggcgaggagctgcgcaaacagattggtgctgcatattatatagaatgc agctcaaaaactcagcagaatgtgaaagcagtttttgatgctgctatcagagtggttatc aagccaccacagaaacaaaaggagaaaaagaaaaagccacgtcgaggatgtctagtcaac atcgtttgtgggcgaaggctagtgtgtctcaaatga

DBGET integrated database retrieval system