Rosa chinensis (China rose): 112176621 Help Entry 112176621         CDS       T06020                                  Name (RefSeq) rac-like GTP-binding protein 3   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism rcn  Rosa chinensis (China rose) Pathway rcn04145   Phagosome rcn04148   Efferocytosis rcn04517   IgSF CAM signaling rcn04518   Integrin signaling rcn04620   Toll-like receptor signaling pathway rcn05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:rcn00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     112176621    04518 Integrin signaling     112176621  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     112176621    04148 Efferocytosis     112176621  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112176621  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     112176621  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rcn04131]     112176621   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rcn04147]     112176621    04031 GTP-binding proteins [BR:rcn04031]     112176621 Membrane trafficking [BR:rcn04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     112176621  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     112176621   Macropinocytosis    Ras GTPases     112176621  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     112176621 Exosome [BR:rcn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112176621   Exosomal proteins of other body fluids (saliva and urine)    112176621   Exosomal proteins of colorectal cancer cells    112176621   Exosomal proteins of bladder cancer cells    112176621 GTP-binding proteins [BR:rcn04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     112176621 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA Motif Other DBs NCBI-GeneID:  112176621 NCBI-ProteinID:  XP_024170413 LinkDB All DBs Position 7:1748500..1752391 Genome browser AA seq 211 aa AA seqDB search MASSASKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYVPTVFDNFSANVVVESTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENILKKWIPELQHYAPGVPVVLAGT KLDLREDKHYLADHPGLVPVTSAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAAIRVVI KPPQKQKEKKKKPRRGCLVNIVCGRRLVCLK NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggcttcaagcgcttccaagttcatcaagtgtgtaacagttggagatggagctgtgggg aagacctgtatgctcatttgttacaccagtaacaagtttcccactgattatgttcccaca gtgtttgataacttcagcgcaaatgtggtggttgaatctacaacagtgaacttaggcctc tgggacacagctgggcaagaagattacaatcgcctaaggccattgagctacagaggtgca gatgtctttgtcctagctttctcattagttagccgtgccagctatgagaacatactgaaa aagtggatccctgaactgcagcattatgctcctggagttccagtagtacttgctggcacc aaactagatcttcgagaggataagcactatttggctgatcacccagggttggtacctgtt actagcgcacagggcgaggagctgcgcaaacagattggtgctgcatattatatagaatgc agctcaaaaactcagcagaatgtgaaagcagtttttgatgctgctatcagagtggttatc aagccaccacagaaacaaaaggagaaaaagaaaaagccacgtcgaggatgtctagtcaac atcgtttgtgggcgaaggctagtgtgtctcaaatga

DBGET integrated database retrieval system