Rosa chinensis (China rose): 112182993 Help Entry 112182993         CDS       T06020                                  Name (RefSeq) sm-like protein LSM8   KO K12627   U6 snRNA-associated Sm-like protein LSm8 Organism rcn  Rosa chinensis (China rose) Pathway rcn03018   RNA degradation rcn03040   Spliceosome Brite KEGG Orthology (KO) [BR:rcn00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     112182993   09123 Folding, sorting and degradation    03018 RNA degradation     112182993  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:rcn03019]     112182993    03041 Spliceosome [BR:rcn03041]     112182993 Messenger RNA biogenesis [BR:rcn03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      112182993   mRNA degradation factors    5'-3' decay     Lsm complex      112182993 Spliceosome [BR:rcn03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     112182993 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM DUF150_C Motif Other DBs NCBI-GeneID:  112182993 NCBI-ProteinID:  XP_024177354 LinkDB All DBs Position 1:complement(15176640..15179942) Genome browser AA seq 98 aa AA seqDB search MSGGPGLESLVDQTISVITNDGRNIVGVLKGFDQATNIILDESHERVFSTKEGVQQLVLG LYIIRGDNISIVGELDADLDSSLDWSKMRAYPLKPVIH NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtccggtggccctggtcttgagtcacttgttgatcaaacaatttcagttatcacaaat gatggacgcaatattgtgggagtcttgaaaggctttgaccaggctactaatatcattctt gatgagtctcatgaacgtgtcttctctacaaaggagggtgttcagcaacttgtgttggga ttgtatataatcaggggcgacaacataagcatcgttggggaactagatgcagatcttgat tcaagccttgactggtcgaagatgagagcgtatcctctgaagcctgtcatccattga

DBGET integrated database retrieval system