Rosa chinensis (China rose): 112188178 Help Entry 112188178         CDS       T06020                                  Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism rcn  Rosa chinensis (China rose) Pathway rcn03030   DNA replication rcn03410   Base excision repair rcn03420   Nucleotide excision repair rcn03430   Mismatch repair rcn03440   Homologous recombination Brite KEGG Orthology (KO) [BR:rcn00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     112188178    03410 Base excision repair     112188178    03420 Nucleotide excision repair     112188178    03430 Mismatch repair     112188178    03440 Homologous recombination     112188178  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:rcn03032]     112188178    03400 DNA repair and recombination proteins [BR:rcn03400]     112188178 DNA replication proteins [BR:rcn03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     112188178 DNA repair and recombination proteins [BR:rcn03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       112188178    MMR (mismatch excision repair)     DNA polymerase delta complex      112188178 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  112188178 NCBI-ProteinID:  XP_024183010 LinkDB All DBs Position 2:complement(29389743..29415293) Genome browser AA seq 121 aa AA seqDB search MATRSNMKGFYKQKKSTIAGGVSKKKKTQGASAAAASLGSDVTQPSALISHGAPDLKDDY DEQEEVLRQFDLNTAYGPCFGITRLARWERACKLGMDPPKEVENLLKSGKARLECLWDGR I NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggcgacgagatcgaatatgaagggtttctacaaacaaaagaagagcaccatcgccggt ggtgtctccaagaagaagaaaacccaaggcgcttccgccgccgccgcctctttgggctcc gacgtcacccaaccctccgcccttatctcccacggcgctcctgatctcaaagatgattat gatgagcaagaggaggtgctgaggcaatttgatttgaacacggcgtatggaccgtgtttt gggatcaccagactcgcaaggtgggagcgtgcctgcaagctggggatggatcctcccaag gaagtggagaatcttttgaagagtgggaaggctcgactcgagtgcttgtgggatggtcgc atttag

DBGET integrated database retrieval system