Rosa chinensis (China rose): 112192200
Help
Entry
112192200 CDS
T06020
Name
(RefSeq) mitochondrial import inner membrane translocase subunit TIM17-2
KO
K17795
mitochondrial import inner membrane translocase subunit TIM17
Organism
rcn
Rosa chinensis (China rose)
Brite
KEGG Orthology (KO) [BR:
rcn00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:
rcn03029
]
112192200
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
rcn02000
]
112192200
Mitochondrial biogenesis [BR:
rcn03029
]
Mitochondrial protein import machinery
Inner mambrane
TIM23 complex
112192200
Transporters [BR:
rcn02000
]
Other transporters
Primary active transporters [TC:
3
]
112192200
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Tim17
IL17R_D_N
DUF3509
Motif
Other DBs
NCBI-GeneID:
112192200
NCBI-ProteinID:
XP_024187600
LinkDB
All DBs
Position
3:38147329..38148289
Genome browser
AA seq
213 aa
AA seq
DB search
MGTPETSREPCPDRILDDVGGAFGMGAVGGSAFHFIKGIYNSPKGARLVGGSQAVRMNAP
RVGGSFAVWGGLFSTFDCTMVYLRQKEDPWNSIIAGAATGGFLQMRQGLGATARSAAMGG
VLLALIEGAGIMLNKIMSEQQQQQQMVMEDPGAGLPGMPQMGGPPGSEESSSVGSWLGGL
FGKAKEPEPAGSGSETKVLESFDAPPVPSFEFK
NT seq
642 nt
NT seq
+upstream
nt +downstream
nt
atgggaactccagaaacgtctcgggagccgtgcccggacagaatcctcgacgacgtgggc
ggagccttcgggatgggcgccgtgggagggtcggcgttccacttcatcaaaggcatctac
aactcccccaagggcgcgcgtctcgtcggcggctcccaggccgtccgcatgaacgccccc
cgcgtcggcggaagcttcgccgtctggggcggactcttctccaccttcgactgcaccatg
gtctacctccgccagaaggaggacccctggaactccatcatcgccggcgcggccaccggc
ggcttcctccagatgcggcagggcctcggcgccaccgcgaggtccgccgccatgggaggg
gtgctgttggccctgatcgaaggcgccgggatcatgctcaacaaaatcatgagcgagcag
caacagcagcagcagatggtgatggaggatcccggtgctggtctgcctgggatgccgcag
atgggcgggcctcccggctcagaagaaagctcctccgttgggtcgtggctgggagggttg
tttggaaaagccaaagagcctgagccggccggcagcggaagcgagacgaaggtcctcgag
agttttgatgcgcctccagtgccttcttttgagttcaagtga
DBGET
integrated database retrieval system