Rosa chinensis (China rose): 112192749 Help Entry 112192749         CDS       T06020                                  Name (RefSeq) calmodulin-7   KO K02183   calmodulin Organism rcn  Rosa chinensis (China rose) Pathway rcn04016   MAPK signaling pathway - plant rcn04070   Phosphatidylinositol signaling system rcn04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:rcn00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     112192749    04070 Phosphatidylinositol signaling system     112192749  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     112192749  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:rcn01009]     112192749   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rcn04131]     112192749    03036 Chromosome and associated proteins [BR:rcn03036]     112192749   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rcn04147]     112192749 Protein phosphatases and associated proteins [BR:rcn01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      112192749 Membrane trafficking [BR:rcn04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     112192749 Chromosome and associated proteins [BR:rcn03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      112192749 Exosome [BR:rcn04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    112192749 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_4 SPARC_Ca_bdg EF-hand_11 UPF0154 DUF5580_M Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin Poly_export MotA_activ DUF6279 PA_Ig-like Fe_hyd_lg_C SurA_N_3 MecA_N Motif Other DBs NCBI-GeneID:  112192749 NCBI-ProteinID:  XP_024188383 LinkDB All DBs Position 3:44501406..44503749 Genome browser AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgatcaactcaccgatgatcagatctctgagttcaaggaagccttcagcctcttc gacaaggacggcgatggctgtatcactaccaaggagcttgggactgtcatgaggtcactg ggccagaacccaaccgaggctgagctccaggacatgatcaatgaagtggatgctgatggt aatgggaccatcgattttcctgaattcttaaacctcatggcaaggaagatgaaagacacc gactctgaggaggagttgaaagaggcttttagagtttttgacaaggatcagaatggtttc atatctgctgctgagctgcgtcatgtgatgacaaatcttggggagaagctcactgatgag gaagtggatgagatgatccgcgaggctgatgttgatggtgatggacagataaattatgag gagtttgtcaaggtgatgatggctaagtga

DBGET integrated database retrieval system