Rosa chinensis (China rose): 112192937 Help Entry 112192937         CDS       T06020                                  Name (RefSeq) SKP1-like protein 6   KO K03094   S-phase kinase-associated protein 1 Organism rcn  Rosa chinensis (China rose) Pathway rcn03083   Polycomb repressive complex rcn04120   Ubiquitin mediated proteolysis rcn04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:rcn00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     112192937    04120 Ubiquitin mediated proteolysis     112192937   09126 Chromosome    03083 Polycomb repressive complex     112192937  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rcn04131]     112192937    04121 Ubiquitin system [BR:rcn04121]     112192937    03036 Chromosome and associated proteins [BR:rcn03036]     112192937 Membrane trafficking [BR:rcn04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     112192937 Ubiquitin system [BR:rcn04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      112192937    Cul7 complex      112192937 Chromosome and associated proteins [BR:rcn03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      112192937   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      112192937 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ BTB MatP Lock_Gag1-like Motif Other DBs NCBI-GeneID:  112192937 NCBI-ProteinID:  XP_024188650 LinkDB All DBs Position 3:complement(10026774..10027214) Genome browser AA seq 146 aa AA seqDB search MSSKKMITLKSLDGRTLEVEEAVAKKSPMIKKMIEDEDVMEDEVDDEDNDNVVHLRKVTH KVLDKVMEYCKRHVNEDEKVVNEDELKAWDQDFIVKTNKSTLCNLLLAAYYLNIQSLLLL LSKNAVHKTGEDKTMEDMRILLACQQ NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcaaagaagatgatcactctgaagagcttggacggacggactcttgaggtggaa gaagcggtggcaaagaagtcgcctatgatcaagaaaatgattgaggatgaagacgtgatg gaggatgaggttgatgacgaggacaacgacaacgtcgttcatctccggaaggtgactcac aaggttttggacaaggtcatggagtactgcaagaggcatgttaacgaggacgagaaggtg gtcaatgaggacgagctcaaggcgtgggatcaagactttattgtcaagactaacaaatcc accctctgcaatcttcttcttgctgcgtactacttgaacatccagagcctgctactcctg ctatccaagaacgctgttcacaagacaggtgaggataagacaatggaggatatgcgaatc cttctcgcatgtcaacagtga

DBGET integrated database retrieval system