Ruegeria conchae: K3740_08640 Help Entry K3740_08640       CDS       T08595                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rcon  Ruegeria conchae Pathway rcon01100   Metabolic pathways rcon01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rcon00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K3740_08640    00074 Mycolic acid biosynthesis     K3740_08640   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K3740_08640 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Motif Other DBs NCBI-ProteinID:  UWR04727 LinkDB All DBs Position complement(1740334..1740591) Genome browser AA seq 85 aa AA seqDB search MSISDRVIAIIAEQAVLEPSDVTPDSTLEDLGIDSLGLVESIFAIEEEFDITVPFNANEP TASDFDISNVAAIIAGIEKLVSEKV NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagcatcagcgaccgcgtcattgcaatcattgccgagcaggccgtgcttgagccttcg gatgtgacgcccgacagcacgctcgaggatttgggcatcgatagcctgggtctggtcgag agcatctttgccatcgaagaagagtttgatatcacggtgcccttcaacgcgaacgaaccc accgcaagtgatttcgatatttcaaacgtggccgcgattattgcgggcatagaaaaactt gtatcggaaaaggtctga

DBGET integrated database retrieval system