Ruegeria conchae: K3740_10535 Help Entry K3740_10535       CDS       T08595                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rcon  Ruegeria conchae Pathway rcon01100   Metabolic pathways rcon01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rcon00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K3740_10535    00074 Mycolic acid biosynthesis     K3740_10535   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K3740_10535 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  UWR01518 LinkDB All DBs Position complement(2121398..2121631) Genome browser AA seq 77 aa AA seqDB search MSDVADRVKKIVVEHLGVEEDKVAENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFISEAS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgtcgcagatcgcgtaaagaagatcgttgttgagcacctgggtgttgaagag gacaaggttgctgaaaacgcctcgttcatcgacgatctgggcgcagacagcctggacacc gttgagttggtaatggcgttcgaagaagagttcggcatcgagattccagacgacgctgcc gagaccatccagacctttggcgacgcggtcaaattcatcagcgaagcttcctaa

DBGET integrated database retrieval system