Rhodobacter capsulatus: RCAP_rcc01678 Help Entry RCAP_rcc01678     CDS       T01213                                  Symbol acpP1 Name (GenBank) acyl carrier protein-1   KO K02078   acyl carrier protein Organism rcp  Rhodobacter capsulatus Pathway rcp01100   Metabolic pathways rcp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rcp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RCAP_rcc01678 (acpP1)    00074 Mycolic acid biosynthesis     RCAP_rcc01678 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RCAP_rcc01678 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  ADE85423 UniProt:  D5ATY4 LinkDB All DBs Position 1815125..1815358 Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLGVEEDKVTETASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFITEAA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatcgcggatcgtgtgaagaagatcgtcgtggagcatctgggcgtggaagag gacaaggtcaccgagaccgcctcgttcatcgacgatctcggcgccgacagccttgacacc gtggaactggtgatggctttcgaagaagaattcggcatcgagatcccggatgacgccgcc gaaaccatccagacctttggcgatgcggtgaaattcatcaccgaagccgcctga

DBGET integrated database retrieval system