Rhizobium croatiense: PYR68_05510 Help Entry PYR68_05510       CDS       T09286                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rct  Rhizobium croatiense Pathway rct01100   Metabolic pathways rct01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rct00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PYR68_05510    00074 Mycolic acid biosynthesis     PYR68_05510   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PYR68_05510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Delta_lysin Motif Other DBs NCBI-ProteinID:  WET74971 LinkDB All DBs Position 1105532..1105768 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDADKVVESASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgttaagaaaattgttattgatcatcttggcgtcgatgcc gacaaggtcgtcgagagcgccagctttatcgacgatctgggcgccgactcgctcgacacg gtcgaacttgtcatggctttcgaagaagaattcggcgttgaaatccccgacgacgctgcc gactcgatcctgacggtcggcgatgcagtgaagtttattgagaaggcccaggcctga

DBGET integrated database retrieval system