Ricinus communis (castor bean): 107261415 Help Entry 107261415         CDS       T01087                                  Name (RefSeq) sm-like protein LSM5   KO K12624   U6 snRNA-associated Sm-like protein LSm5 Organism rcu  Ricinus communis (castor bean) Pathway rcu03018   RNA degradation rcu03040   Spliceosome Brite KEGG Orthology (KO) [BR:rcu00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     107261415   09123 Folding, sorting and degradation    03018 RNA degradation     107261415  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:rcu03019]     107261415    03041 Spliceosome [BR:rcu03041]     107261415 Messenger RNA biogenesis [BR:rcu03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      107261415   mRNA degradation factors    5'-3' decay     Lsm complex      107261415 Spliceosome [BR:rcu03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     107261415 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM DUF7452 Ntox4 Motif Other DBs NCBI-GeneID:  107261415 NCBI-ProteinID:  XP_015575945 LinkDB All DBs Position 7:complement(24604581..24608395) Genome browser AA seq 87 aa AA seqDB search MANNPSQLLPSELIDRCIGSKIWVIMKGDKELVGTLRGFDVYVNMVLEDVTEYEITAEGR RITKLDQILLNGNNIAILVPGGSPDPE NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggctaacaatccctcccagcttctcccttcagagcttatagatcgctgcattgggtca aaaatctgggtaattatgaaaggagataaggagcttgttggcactctaagaggatttgac gtttatgtgaatatggtgcttgaagatgtcactgaatatgagatcactgctgaagggcgg cggataacaaagcttgatcagattctactgaatgggaacaacattgccattctggttcct ggtggttcccctgatccagaatga

DBGET integrated database retrieval system