Ricinus communis (castor bean): 11542333 Help Entry 11542333          CDS       T01087                                  Symbol psbF, RCOM_ORF00059 Name (RefSeq) photosystem II protein VI   KO K02708   photosystem II cytochrome b559 subunit beta Organism rcu  Ricinus communis (castor bean) Pathway rcu00195   Photosynthesis rcu01100   Metabolic pathways Module rcu_M00161   Photosystem II rcu_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:rcu00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     11542333 (psbF)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:rcu00194]     11542333 (psbF) Photosynthesis proteins [BR:rcu00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     11542333 (psbF) SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_B559 Motif Other DBs NCBI-GeneID:  11542333 NCBI-ProteinID:  YP_005090194 LinkDB All DBs Position CP Genome browser AA seq 39 aa AA seqDB search MTIDRTYPIFTVRWLTVHGLAVPTVFFLGSISAMQFIQR NT seq 120 nt NT seq  +upstreamnt  +downstreamnt atgaccatagatcgaacctatccaatttttacagtacgatggttgactgttcacggacta gctgtacctaccgttttttttttggggtcaatatcagcaatgcagttcatccaacgataa

DBGET integrated database retrieval system