Ricinus communis (castor bean): 8261333 Help Entry 8261333           CDS       T01087                                  Name (RefSeq) autophagy-related protein 8i   KO K08341   GABA(A) receptor-associated protein Organism rcu  Ricinus communis (castor bean) Pathway rcu04136   Autophagy - other Brite KEGG Orthology (KO) [BR:rcu00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     8261333  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rcu04131]     8261333    04121 Ubiquitin system [BR:rcu04121]     8261333    03029 Mitochondrial biogenesis [BR:rcu03029]     8261333 Membrane trafficking [BR:rcu04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     8261333 Ubiquitin system [BR:rcu04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    8261333 Mitochondrial biogenesis [BR:rcu03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     8261333 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATG8 APG12 Motif Other DBs NCBI-GeneID:  8261333 NCBI-ProteinID:  XP_002519308 UniProt:  B9RZY9 LinkDB All DBs Position 9:628584..630232 Genome browser AA seq 115 aa AA seqDB search MGKAKSFQAFEQRLQESNTIIAKYPGRVPVIIERYSKTDLPEMEKRKYLVPRATSVGQFI HILSGRLHLAPGKALFVFVKNTLPPTASLMDSVYESYKDDDGFLYMYYSSEKTFG NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgggtaaagctaagtctttccaagcattcgagcaaagactccaagaatcaaatactatc attgccaaatacccaggccgagtccctgtgattatagaaagatattcaaagacggacctg cctgaaatggagaaaagaaaatatctagttccccgagctacgtctgtcgggcaattcatc cacatcttaagtggtaggctgcatttggctcctggaaaagctctgtttgtatttgtaaag aacacattgcctccaacagcaagccttatggattcagtgtatgaatcttacaaggatgat gacgggttcctctatatgtattacagcagcgagaagacctttggctga

DBGET integrated database retrieval system