Ricinus communis (castor bean): 8263332 Help Entry 8263332           CDS       T01087                                  Name (RefSeq) sm-like protein LSM8   KO K12627   U6 snRNA-associated Sm-like protein LSm8 Organism rcu  Ricinus communis (castor bean) Pathway rcu03018   RNA degradation rcu03040   Spliceosome Brite KEGG Orthology (KO) [BR:rcu00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     8263332   09123 Folding, sorting and degradation    03018 RNA degradation     8263332  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:rcu03019]     8263332    03041 Spliceosome [BR:rcu03041]     8263332 Messenger RNA biogenesis [BR:rcu03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      8263332   mRNA degradation factors    5'-3' decay     Lsm complex      8263332 Spliceosome [BR:rcu03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     8263332 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM DUF150_C Motif Other DBs NCBI-GeneID:  8263332 NCBI-ProteinID:  XP_002523867 UniProt:  B9SCZ8 LinkDB All DBs Position 8:complement(13764166..13766374) Genome browser AA seq 98 aa AA seqDB search MSTGPGLESLVDQNISVITNDGRNIVGILKGFDQATNIILDESHERVYSTKEGVQLHVLG LYIIRGDNISIVGELDEELDSNLDLASLRAHPLKPLIP NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtctaccggccctggactcgagtcccttgtagatcaaaatatttcagttatcactaat gatggccgcaatatagtgggaatcctgaaaggctttgaccaggccacaaatattatcctt gacgaatcgcatgaacgtgtttactccactaaggagggtgttcaactacatgttctggga ctgtacataataaggggtgacaacataagcattgttggggaacttgatgaagaactggat tcgaatcttgacttggcaagcctaagagctcatccactgaagccactcatcccttga

DBGET integrated database retrieval system