Ricinus communis (castor bean): 8265387 Help Entry 8265387           CDS       T01087                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism rcu  Ricinus communis (castor bean) Brite KEGG Orthology (KO) [BR:rcu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rcu03036]     8265387 Chromosome and associated proteins [BR:rcu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     8265387 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  8265387 NCBI-ProteinID:  XP_002509686 UniProt:  B9RC02 LinkDB All DBs Position 5:24618129..24618865 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK IFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtcaggaagaggaaagggagggaaaggattaggaaagggaggagcaaagaggcacagg aaggtattaagagataacattcaaggtattacaaagccagcaattagacgtcttgctcgc agaggaggcgtcaagcgtatcagtggtctaatttacgaagagacaagaggcgttttaaag atctttttggagaatgtgattcgtgatgctgttacttacactgagcatgctcgtagaaaa actgttactgccatggatgtcgtttatgctcttaaacgtcaaggccgtaccctctacggc tttggtggttga

DBGET integrated database retrieval system