Ricinus communis (castor bean): 8266271 Help Entry 8266271           CDS       T01087                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism rcu  Ricinus communis (castor bean) Brite KEGG Orthology (KO) [BR:rcu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:rcu03041]     8266271   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:rcu04052]     8266271 Spliceosome [BR:rcu03041]  Complex B   Other components    Complex B specific factors     8266271 Cytokines and neuropeptides [BR:rcu04052]  Neuropeptides   Neuropeptides (Unclassified)    8266271 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 OTU1_UBXL Crinkler Motif Other DBs NCBI-GeneID:  8266271 NCBI-ProteinID:  XP_002529942 UniProt:  B9SVC3 LinkDB All DBs Position 8:complement(16096727..16098137) Genome browser AA seq 73 aa AA seqDB search MIEVILNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRPEKIRIQKWYTIYKDHITLQDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatagaggtgatattgaatgacagattaggtaagaaagttcgagtcaaatgcaacgaa gacgacacaatcggcgacctcaagaagctggtggctgctcaaactggcacccgacccgaa aagattcggattcagaaatggtatactatttacaaggatcacattactctccaggactac gagattcatgacggcatgggccttgagctctactacaactaa

DBGET integrated database retrieval system