Ricinus communis (castor bean): 8274704 Help Entry 8274704           CDS       T01087                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism rcu  Ricinus communis (castor bean) Pathway rcu03083   Polycomb repressive complex rcu04120   Ubiquitin mediated proteolysis rcu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:rcu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     8274704    04120 Ubiquitin mediated proteolysis     8274704   09126 Chromosome    03083 Polycomb repressive complex     8274704  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rcu04131]     8274704    04121 Ubiquitin system [BR:rcu04121]     8274704    03036 Chromosome and associated proteins [BR:rcu03036]     8274704 Membrane trafficking [BR:rcu04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     8274704 Ubiquitin system [BR:rcu04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      8274704    Cul7 complex      8274704 Chromosome and associated proteins [BR:rcu03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      8274704   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      8274704 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  8274704 NCBI-ProteinID:  XP_002510577 UniProt:  B9R8D4 LinkDB All DBs Position 2:complement(1048879..1050755) Genome browser AA seq 157 aa AA seqDB search MSAGKKITLKSSDGETFEVEELVALESQTIKHMIEDDCADSGIPLPNVTSKILSKVIEYC KKHVETPKSEDRPSSADDDLKAWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD MIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 474 nt NT seq  +upstreamnt  +downstreamnt atgtcagcagggaagaaaataacgctaaaaagctcagatggagagacatttgaggtggag gagttggtggcgctggaatcgcagacgataaagcacatgatagaggacgattgcgccgat agcggaatccctctgcctaatgtaacaagcaagatcctttctaaggtaattgagtactgc aagaagcacgtcgagactcctaaatccgaagatcgtccttcttctgctgatgatgacctt aaagcctgggacgctgaattcgtcaaagttgatcaggctactctcttcgatcttatcctg gctgccaattatctgaacatcaagagcttgctggatctaacttgtcagacagtggcagac atgatcaagggaaaaactccagaggagatccgcaaaactttcaacatcaagaatgacttt actcccgaggaagaggaggaagttcgcagagagaaccagtgggcatttgagtaa

DBGET integrated database retrieval system