KEGG   Ricinus communis (castor bean): 8276874
Entry
8276874           CDS       T01087                                 
Name
(RefSeq) monoterpene synthase
  KO
K21926  (+)-alpha-terpineol/(4S)-limonene synthase [EC:4.2.3.112 4.2.3.16]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu00902  Monoterpenoid biosynthesis
rcu01100  Metabolic pathways
rcu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00902 Monoterpenoid biosynthesis
    8276874
Enzymes [BR:rcu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.16  (4S)-limonene synthase
     8276874
    4.2.3.112  (+)-alpha-terpineol synthase
     8276874
SSDB
Motif
Pfam: Terpene_synth_C Terpene_synth Terpene_syn_C_2 DUF6793
Other DBs
NCBI-GeneID: 8276874
NCBI-ProteinID: XP_002515689
UniProt: B9RPM0
LinkDB
Position
Unknown
AA seq 596 aa
MALHTTFSFSPALLTSTRLPAFHLPKNVPQPTTKLHKSVSIRCLSSDVITIEDPLTTRRS
ANYPSSAWDYDHLLQSLAANDSEDKYRRQVEGLKEEVRESLMNGEMKPLAKLELVDAVQR
LGLKYHFEMEIKNALHILHSNASSDGNDELYSVALRYRLFRQHGYDVSKDVFERFKDETG
KFKASLCKDAKGLLSMYEASFFGLEGEDIIDEAKAFSTGHLKDLKGTLCGSLARKVEHAL
DMPVHWRLTRMEARWFIDTYEQEQHLNPTLLRLAKLEFNMVQAIHQKEVSKLARWWMDLG
LNKMAFARDRLVEHYYWCCGMAFEPQFGLFREMGTKIICLITTIDDVYDVYGSLEELELF
TDFVDRWDVNGIDKLPDPIRTIFLAMYNTGNEIGYTIIREKGFNIIPYLSKTWANLCKAY
LVEAKWYHKGYKPTLEKYLDNAVVSIAAPLMLFSSYFLTADKITVEALDYINKLPSLMRC
SSLVLRLTNDLGTSSDELARGDNLKSIQCYMNETGVSDNVARDHINDLVHEAWKVMNKEM
LGNYPFQDTFIHANPNLARAAQFFYHYGDGHGVPGNETKGRLFPLLLEPVPVNQKD
NT seq 1791 nt   +upstreamnt  +downstreamnt
atggctctccacaccaccttttcattctcacctgctcttctcacatcaactcgtcttcct
gctttccatctgccaaaaaatgtacctcagcccaccacaaaactccacaagtctgtgtct
atccggtgcctttccagtgatgttattaccattgaagatcctctgacgacaagacgttcg
gcaaactacccctcaagtgcctgggattatgatcatctcttgcagtcacttgctgccaat
gactctgaggataaatataggagacaggttgaggggctgaaggaggaagtgagggagagt
cttatgaatggagagatgaagcccttggctaagcttgagcttgttgatgcagttcaaagg
ctaggtttgaagtaccattttgagatggaaataaaaaatgctttacacattttgcattca
aatgcgagtagtgatggtaatgacgaactttattctgttgccctccggtataggttgttc
agacaacatggatatgatgtttccaaagatgtgtttgagaggttcaaagatgagactggc
aagttcaaggcatcactatgcaaggatgcgaaagggctgttgagtatgtatgaggcttcc
ttctttgggttagaaggtgaagatattatagatgaagccaaggccttcagcactggacat
ttgaaggacctgaagggaaccttgtgtggaagcttggccaggaaagtagagcatgctttg
gatatgcctgtccattggaggctgacaaggatggaagccagatggttcattgatacttat
gagcaagagcaacacctcaaccctactttacttcgacttgccaagttggaattcaacatg
gtacaagctattcatcaaaaggaggttagcaaattggcaaggtggtggatggatctggga
ttaaacaagatggcttttgcccgagacaggctagtggagcattactattggtgctgtggg
atggcttttgagccacaatttggtttattcagagaaatgggtacaaaaattatatgttta
ataacaacaatagatgatgtttacgacgtctacggttctctggaagaattggagctcttc
acagattttgttgacaggtgggatgtcaatggaattgacaagcttcctgatccgatcaga
acaatcttcctggctatgtacaatacaggcaacgaaattggctacacaatcataagggag
aaaggcttcaatattataccatatctaagcaaaacgtgggcgaacctctgcaaggcatac
cttgtagaggcgaagtggtaccataagggatacaaaccaacactagagaagtatcttgac
aatgcagttgtttcaatagcagcaccccttatgttattttcttcctacttcctcacggca
gataaaataactgtggaggcattggactacataaacaaacttccaagccttatgcgctgc
tcctccctggttctccgtctcactaacgatttgggaacttcatcggatgaattggcaaga
ggggacaatctaaaatcaatccagtgctacatgaatgaaactggagtttcagataatgtt
gctcgcgaccacattaatgatttagtgcatgaggcatggaaagtgatgaataaggaaatg
cttggtaattatcctttccaggatacttttatacatgccaatccaaatcttgctcgagca
gctcagttcttttaccattatggagatggacatggcgtcccaggcaatgaaacaaaggga
cgtcttttccccttactgctggagcctgttccagtaaaccagaaagactaa

DBGET integrated database retrieval system