Ricinus communis (castor bean): 8280368 Help Entry 8280368           CDS       T01087                                  Name (RefSeq) calmodulin-7   KO K02183   calmodulin Organism rcu  Ricinus communis (castor bean) Pathway rcu04016   MAPK signaling pathway - plant rcu04070   Phosphatidylinositol signaling system rcu04075   Plant hormone signal transduction rcu04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:rcu00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     8280368    04070 Phosphatidylinositol signaling system     8280368    04075 Plant hormone signal transduction     8280368  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     8280368  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:rcu01009]     8280368   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rcu04131]     8280368    03036 Chromosome and associated proteins [BR:rcu03036]     8280368   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rcu04147]     8280368 Protein phosphatases and associated proteins [BR:rcu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      8280368 Membrane trafficking [BR:rcu04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     8280368 Chromosome and associated proteins [BR:rcu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      8280368 Exosome [BR:rcu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    8280368 SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 CFAP251_C EF-hand_FSTL1 EH Allatotropin-like_C EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 SAPC2_N UPF0154 DUF5580_M Dockerin_1 EFhand_Ca_insen EF-hand_EFHB_C Caleosin FCaBP_EF-hand EF-hand_STIM1 SPEF2_C PA_Ig-like SurA_N_3 DUF6279 MecA_N Motif Other DBs NCBI-GeneID:  8280368 NCBI-ProteinID:  XP_002527384 UniProt:  A0ACK6BDF5 LinkDB All DBs Position 10:24747118..24748903 Genome browser AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggatcagcttactgatgaccaaatctctgagttcaaggaagccttcagtttgttc gacaaagatggagatggttgcatcaccacaaaggagcttggaactgtgatgagatcgctg gggcagaaccctacagaggcagagctccaggacatgattaatgaagttgatgctgatggg aatggaactattgatttcccggagtttctgaacctgatggccaggaagatgaaagacacc gactctgaggaggagctgaaagaggcattcagagtgtttgacaaggatcagaatggcttc atctctgctgccgagctgcgccatgtgatgacaaaccttggcgagaagcttaccgatgaa gaagttgatgaaatgataagggaggcagatgtcgatggtgatggccagataaattacgag gagtttgtgaaggtcatgatggccaagtga

DBGET integrated database retrieval system