Ricinus communis (castor bean): 8284087 Help Entry 8284087           CDS       T01087                                  Name (RefSeq) elongin-C   KO K03872   elongin-C Organism rcu  Ricinus communis (castor bean) Pathway rcu04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:rcu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     8284087  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:rcu04121]     8284087    03400 DNA repair and recombination proteins [BR:rcu03400]     8284087 Ubiquitin system [BR:rcu04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      8284087    Cul5 complex      8284087 DNA repair and recombination proteins [BR:rcu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      8284087 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  8284087 NCBI-ProteinID:  XP_002520493 UniProt:  B9S3C4 LinkDB All DBs Position 1:35902238..35904694 Genome browser AA seq 98 aa AA seqDB search MRKEDTVKLISAEGFEFVIDKEAAMVSQTIRNMLTSPGSFAETQHGEVTFPEISTTILEK ICQYFYWSLQYAKGKETEFPIEPELTLELMMAANYLHT NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgagaaaggaagacacagtgaaactaataagcgcagagggctttgagtttgtaattgac aaagaagcagccatggtttcacagacaatccgcaacatgctcacctctccagggagtttt gctgagacacaacatggggaagtgacatttccggagataagcactacgattctagaaaag atctgccagtatttctattggtcccttcagtatgccaagggaaaggagactgaattccca attgaacctgaactgaccctggagctgatgatggctgctaattatctccatacttga

DBGET integrated database retrieval system