Teichococcus cervicalis: PFY06_11160 Help Entry PFY06_11160       CDS       T08750                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism rcv  Teichococcus cervicalis Brite KEGG Orthology (KO) [BR:rcv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:rcv03032]     PFY06_11160    03036 Chromosome and associated proteins [BR:rcv03036]     PFY06_11160    03400 DNA repair and recombination proteins [BR:rcv03400]     PFY06_11160 DNA replication proteins [BR:rcv03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     PFY06_11160 Chromosome and associated proteins [BR:rcv03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     PFY06_11160 DNA repair and recombination proteins [BR:rcv03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       PFY06_11160 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  WBV41794 LinkDB All DBs Position 2366674..2366943 Genome browser AA seq 89 aa AA seqDB search MSKAFIAQVLQESLGCTGVAANRAAGELIAAIVKDMKKQGGFTLPSFGTFTVRKTKARKG MNPRTGEPVKIKAGKTVRFKASPNLRKAV NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcgaaggcattcatcgcgcaggtgctgcaggaatccctgggctgcaccggcgttgcc gccaatcgcgcggccggcgagctgatcgccgccatcgtcaaggacatgaagaaacagggc ggcttcaccctgcccagcttcggcaccttcaccgtgcgcaagaccaaggcgcgcaagggc atgaacccgcgcaccggcgaaccggtgaagatcaaggccggcaagacggtgcgcttcaag gcctcgcccaatctgcgcaaggcggtctga

DBGET integrated database retrieval system