Roseobacter denitrificans: RD1_2841
Help
Entry
RD1_2841 CDS
T00376
Name
(GenBank) response regulator receiver domain protein
Organism
rde
Roseobacter denitrificans
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
Motif
Other DBs
NCBI-ProteinID:
ABG32367
RoseoBase:
RD1_2841
UniProt:
Q165H6
LinkDB
All DBs
Position
complement(2711271..2711654)
Genome browser
AA seq
127 aa
AA seq
DB search
MSKHVLLVEDELNIIEAIRFLLTREGFQVDTHSNGADASETIRALQPDLVVLDVMLPGKS
GFDILEELRADDATADLPVLMLTARGQSRDREMAEKAGVSRFMTKPFSNAEVLTAVRDLL
YVHQQKG
NT seq
384 nt
NT seq
+upstream
nt +downstream
nt
atgagcaaacacgtacttttggtcgaggatgagttgaacatcatcgaggcgatccgcttt
ttgctcacgcgcgaaggatttcaggtggatacccatagcaacggtgcggatgcatccgag
accatacgggcattgcaaccggatctggttgtgctggacgtgatgcttccgggcaagagc
gggtttgatattctcgaggaattgcgcgcagatgacgcaaccgccgatctgccggttctg
atgctcaccgcccgtggccagagccgggacagggagatggccgagaaagcgggtgtaagc
cgcttcatgaccaagccgttctccaatgccgaggtgctcaccgctgtgcgggatctgctc
tacgttcatcaacagaaaggctga
DBGET
integrated database retrieval system