Rhizorhabdus dicambivorans: CMV14_11450 Help Entry CMV14_11450       CDS       T05084                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rdi  Rhizorhabdus dicambivorans Pathway rdi01100   Metabolic pathways rdi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rdi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CMV14_11450    00074 Mycolic acid biosynthesis     CMV14_11450   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CMV14_11450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 DUF1493 DUF1409 Motif Other DBs NCBI-ProteinID:  ATE64939 UniProt:  A0A2A4G2F2 LinkDB All DBs Position 2410624..2410860 Genome browser AA seq 78 aa AA seqDB search MSETAERVKKIVVEHLGVEAEKVTEEASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKIATVKDAISYIESHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgagaccgctgagcgcgttaagaagatcgttgtcgagcatctgggcgtcgaggcc gagaaggtcaccgaggaagccagcttcatcgacgatctgggcgcggacagcctcgacatc gtcgagctggtgatggccttcgaagaggaattcggcgtcgagattcccgacgacgcggct gagaagatcgcgaccgtcaaggacgccatcagctatatcgagagccacaagggctga

DBGET integrated database retrieval system