Rhizorhabdus dicambivorans: CMV14_17770 Help Entry CMV14_17770       CDS       T05084                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism rdi  Rhizorhabdus dicambivorans Pathway rdi00190   Oxidative phosphorylation rdi01100   Metabolic pathways Module rdi_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:rdi00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     CMV14_17770  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:rdi00194]     CMV14_17770 Photosynthesis proteins [BR:rdi00194]  Photosystem and electron transport system   F-type ATPase [OT]    CMV14_17770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C DUF5671 SP_C-Propep Motif Other DBs NCBI-ProteinID:  ATE66024 UniProt:  A0A2A4FZI7 LinkDB All DBs Position complement(3778660..3778887) Genome browser AA seq 75 aa AA seqDB search MDAEAAKLIGAGLAAIGVGMAALGVGNVFGSFLESALRNPAAADGQQGRLFIGFAAAELL GLLAFVVAMILLFVA NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggacgcagaagccgcaaagctgatcggtgccggtctggccgccatcggcgtgggcatg gccgcgctgggcgtgggcaacgtgttcggctcgttcctcgagtccgcgctgcgcaacccg gccgctgccgatggccagcagggccgtctgttcatcggcttcgccgccgctgagcttctc ggcctgctggcgttcgtcgtagcgatgatcctgctgttcgtcgcctaa

DBGET integrated database retrieval system