Rothia dentocariosa: HMPREF0733_10609 Help Entry HMPREF0733_10609  CDS       T01343                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism rdn  Rothia dentocariosa Pathway rdn01100   Metabolic pathways rdn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rdn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HMPREF0733_10609    00074 Mycolic acid biosynthesis     HMPREF0733_10609   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HMPREF0733_10609 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  ADP40067 UniProt:  E3H1E0 LinkDB All DBs Position complement(662516..662773) Genome browser AA seq 85 aa AA seqDB search MTETPVNTASLEEFVTQQVIDMGVPASTVKLDAKIDSMGLDSLDVVELTQAVKKQLMIPV KPKDFENAATLQDAVDIIREKAQEK NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgactgagacccccgttaacaccgcatccctggaagagttcgtgacccagcaggtgatc gacatgggcgtgcccgccagcaccgttaaactcgatgccaaaatcgattcgatggggctc gactccctagacgttgttgagctcacccaggcggtcaagaagcagctgatgattcccgtc aagcccaaggattttgaaaacgccgccaccctacaagatgccgtagatattattcgtgaa aaggcacaggagaagtga

DBGET integrated database retrieval system