Roseateles depolymerans: RD2015_1494 Help Entry RD2015_1494       CDS       T04166                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism rdp  Roseateles depolymerans Pathway rdp02024   Quorum sensing rdp03018   RNA degradation Brite KEGG Orthology (KO) [BR:rdp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     RD2015_1494  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     RD2015_1494  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:rdp03019]     RD2015_1494    03036 Chromosome and associated proteins [BR:rdp03036]     RD2015_1494 Messenger RNA biogenesis [BR:rdp03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      RD2015_1494 Chromosome and associated proteins [BR:rdp03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     RD2015_1494 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  ALV05979 UniProt:  A0A0U3N172 LinkDB All DBs Position 1759211..1759453 Genome browser AA seq 80 aa AA seqDB search MSNKGQLLQDPFLNLLRKEHVPVSIYLVNGIKLQGHIESFDQYVVLLRNTVTQMVYKHAI STVVPGRAVNFHAGDGGEAN NT seq 243 nt NT seq  +upstreamnt  +downstreamnt gtgagcaacaaaggacaactcttgcaagaccccttcctgaacctgctgcgcaaggagcat gtgccggtgtccatctatctggtcaacggcatcaagctgcaaggccacattgagtccttt gaccaatacgtggtgctgctgcgcaatacggtcacgcagatggtctacaagcatgccatc tccacggtcgtgcccggccgcgccgtcaacttccacgctggcgacggcggcgaagccaac tga

DBGET integrated database retrieval system