KEGG   Rhodococcus erythropolis BG43: XU06_28635
Entry
XU06_28635        CDS       T03842                                 

Definition
(GenBank) amidase
  KO
K19795  ureidomalonase [EC:3.5.1.95]
Organism
reb  Rhodococcus erythropolis BG43
Pathway
reb00240  Pyrimidine metabolism
reb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:reb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    XU06_28635
Enzymes [BR:reb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.95  N-malonylurea hydrolase
     XU06_28635
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-ProteinID: AKE00188
LinkDB
Position
complement(6187852..6189330)
AA seq 492 aa
MVHAADPVDESVSGAPENRELVMADAVTLSGLIRRREVSCVEVMDSYLDQIEVHNPAVNA
IVALRDREALTAEARERDSQLASGQYLGWMHGFPHAVKDLSAAKGLPFTSGSPMFADRIA
EEDDLFVKRIKSAGAIVIGKTNTPEFGLGSQTYNPVWGTTVSPYDNSRTAGGSSGGAAAS
LALRMLPVADGSDYMGSLRNPSAFNNVVGFRPSWGRIPETGFIAQGAVVGPMGRTVTDVA
HLLSTMAGPDAYAPLGIRENPAVFTESLARDLKGSRIAWVGDWNGYLATEPGVLELCESS
FEVFEQLGCRVEAALPDFKPEDIWQLFLRWRWWAQLGLIDQYNDPSLRELMKPELLWELG
HAVTLSALDVTKAAEARNGWLSAITKMFETYDYILAPSAQVFPFDKNTHWPETVDGRSMD
TYHRWMETVVPWTMAGVPVAGMPVGFDDRSLPMGIQIIGRHGADVDVLQLAYAFEQATQW
VERVLPPALRVN
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggttcatgctgctgaccctgtcgacgagagcgtttccggtgcgcccgagaatcgcgag
ctcgtcatggccgatgcggtcacgctcagtggtctgatacgcaggcgtgaagtgtcgtgt
gtcgaggtgatggacagctacctcgaccagatcgaagttcataacccggcggtgaacgcg
atcgtcgcattgcgggatcgggaagcgttgacggcggaggcgcgcgagcgtgattcgcag
ttggcgagtgggcagtatctcggttggatgcacgggtttccgcatgcggtgaaggatctt
tcggcagccaagggtctgccgttcacgtccgggtcgccgatgttcgcggatcgaatcgcc
gaagaggacgacctgttcgtcaagcggatcaagtctgccggtgccatcgtgatcggcaag
acgaacacaccggagttcgggctcggatcgcagacgtacaacccggtgtggggtacgacg
gtgtcgccgtacgacaattcgcgcactgccggcggtagcagcggaggcgcagcagcgtcg
ttggcgcttcgcatgctgccggtggctgatggaagcgattacatgggttcgctccgaaac
ccgtcggcgttcaacaacgttgttgggtttcgaccttcctggggtcggataccggagacg
ggattcatcgctcagggcgctgttgtgggtccgatgggccgaaccgtcaccgacgtggct
cacctgctctccacgatggcgggaccggatgcctatgcaccgttggggattcgtgagaat
cccgctgtgttcaccgaaagcctcgcacgggatctgaagggctctcggatcgcatgggtc
ggtgactggaacggctacctggcaaccgaacctggagttctcgagttgtgcgaatcctcg
ttcgaggtcttcgaacagttggggtgccgcgtcgaggctgcgcttcctgacttcaaaccc
gaggacatctggcaactgttcctgcgatggcgttggtgggcgcagctcggtttgatcgat
cagtacaacgatccgagtttgcgtgagttgatgaagcccgaactgttgtgggaactcggg
catgcggtcaccctctcggcactcgacgtgaccaaggctgcggaggcccgcaacggctgg
ctgtcggccattaccaagatgttcgaaacctacgactacattctcgcgccgagtgctcag
gtgtttcctttcgacaagaacactcactggcccgagaccgtcgacgggcggtcgatggac
acgtatcaccggtggatggagacggttgttccctggacgatggccggggttccggttgcg
gggatgccggtcggcttcgacgatcgttcgcttcccatgggtatccagatcatcggtcgg
cacggagccgacgtggacgtactccaactcgcctacgcattcgagcaggcaacccagtgg
gtcgagcgggttcttcctcccgcactccgcgtgaactga

DBGET integrated database retrieval system