Roseicyclus elongatus: roselon_02406 Help Entry roselon_02406     CDS       T03060                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism red  Roseicyclus elongatus Pathway red01100   Metabolic pathways red01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:red00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     roselon_02406    00074 Mycolic acid biosynthesis     roselon_02406   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     roselon_02406 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AHM04733 UniProt:  W8RU36 LinkDB All DBs Position 2314975..2315208 Genome browser AA seq 77 aa AA seqDB search MSDVADRVKKIVVEHLSVEEDKVTESASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFIKEAQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgttgcagatcgcgtgaagaaaatcgttgtcgagcacctgagcgtggaagag gacaaggtgaccgagagcgcctcgttcatcgacgatctgggcgccgactcgctggacacg gtcgagctggtcatggccttcgaagaggagttcggcatcgagatccccgatgacgccgcc gaaacgatccagaccttcggcgacgcggtcaagttcatcaaggaagcgcagtaa

DBGET integrated database retrieval system