Roseicyclus elongatus: roselon_03001 Help Entry roselon_03001     CDS       T03060                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism red  Roseicyclus elongatus Pathway red01100   Metabolic pathways red01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:red00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     roselon_03001    00074 Mycolic acid biosynthesis     roselon_03001   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     roselon_03001 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  AHM05280 UniProt:  W8SRW9 LinkDB All DBs Position complement(2865021..2865290) Genome browser AA seq 89 aa AA seqDB search MTENVRDKVVEIIAEQAVLDVEDVKMDSTLEDLGIDSLGLVESIFAIEEAFDIQVPFNAN EPEQSDFDISSVAAIVTAVKGLVTEQKGG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaccgaaaatgtgcgtgacaaggtagtcgagatcatcgccgaacaggccgtgctcgac gtcgaggacgtcaagatggactcgacgctggaggatctcgggatcgacagcctgggattg gtcgagtcgattttcgccatcgaggaagcgttcgatatccaggtgccgttcaacgcgaac gagccggagcagagcgatttcgacatctcttcggtggcggccatcgtgacggcggtgaaa ggcctcgtcacggagcaaaagggcggctga

DBGET integrated database retrieval system