Cupriavidus necator H16: H16_A2566 Help Entry H16_A2566         CDS       T00416                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism reh  Cupriavidus necator H16 Pathway reh01100   Metabolic pathways reh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:reh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H16_A2566 (acpP)    00074 Mycolic acid biosynthesis     H16_A2566 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H16_A2566 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 MAP Motif Other DBs NCBI-ProteinID:  CAJ93649 UniProt:  Q0K8M2 A0AAE6DHF2 LinkDB All DBs Position 1:complement(2773574..2773813) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEADIKNESSFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYATAHVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaatatcgaacaacgcgtcaagaaaatcgtggcagaacagcttggcgtggccgag gcagatatcaagaacgaatcgtcgttcgtgaacgatctcggtgcggactcgctggacacg gttgaactcgtgatggcgttggaagatgaattcggcatggaaattcctgatgaggaagcc gaaaagatcacgaccgtgcaacaggctatcgactacgccaccgcgcacgtcaaggcctaa

DBGET integrated database retrieval system