Cupriavidus necator H16: PHG106 Help Entry PHG106            CDS       T00416                                  Name (GenBank) conserved hypothetical protein   KO K03746   DNA-binding protein H-NS Organism reh  Cupriavidus necator H16 Brite KEGG Orthology (KO) [BR:reh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:reh03036]     PHG106    03400 DNA repair and recombination proteins [BR:reh03400]     PHG106 Chromosome and associated proteins [BR:reh03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     PHG106 DNA repair and recombination proteins [BR:reh03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       PHG106 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N Mito_fiss_reg PRIMA1 Motif Other DBs NCBI-ProteinID:  AAP85859 UniProt:  Q7WXL8 LinkDB All DBs Position pHG1:100237..100506 Genome browser AA seq 89 aa AA seqDB search MTEINERAAAIRWIQAEMADYGLTMEELAAAGCFDPPPPPPPPLPAPAPPPVVCYRNAAG QTWDGQGDMPDWLQRAANAGQSVEFYRAG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgacagaaatcaatgagcgggccgcggcgatccgctggatccaggcggagatggccgac tacgggctgaccatggaggagctggcagcggcggggtgcttcgatccgccgccccctccg ccgccgccgctacccgcaccagcgccaccgccagtggtgtgctaccgcaacgccgcgggg cagacttgggacgggcagggcgacatgcccgactggctgcagcgggcggccaatgcgggg cagtcggtggagttttaccgggccggatag

DBGET integrated database retrieval system