Rhizobium etli bv. mimosae IE4771: IE4771_PB00360 Help Entry IE4771_PB00360    CDS       T03310                                  Name (GenBank) DNA-binding HU-like protein   KO K03530   DNA-binding protein HU-beta Organism rei  Rhizobium etli bv. mimosae IE4771 Brite KEGG Orthology (KO) [BR:rei00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:rei03032]     IE4771_PB00360    03036 Chromosome and associated proteins [BR:rei03036]     IE4771_PB00360    03400 DNA repair and recombination proteins [BR:rei03400]     IE4771_PB00360 DNA replication proteins [BR:rei03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     IE4771_PB00360 Chromosome and associated proteins [BR:rei03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     IE4771_PB00360 DNA repair and recombination proteins [BR:rei03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       IE4771_PB00360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  AIC30086 UniProt:  A0A060IEK0 LinkDB All DBs Position pRetIE4771b:complement(355720..355998) Genome browser AA seq 92 aa AA seqDB search MTTTNEIADKIAAGHGLTKAQSKMIVEAVFAAITTAATSGAETSIPAFGKFKVKATPERQ ARNPATGATIKVAAAKKLTFPPAKALKDAMNT NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaccaccaccaatgaaatcgctgataagattgccgccggccacggtctgacgaaagcg cagagcaaaatgatcgtggaggccgtcttcgccgcaatcacgaccgctgctacatccggc gccgagacgtcaattcccgcgttcggcaagttcaaggtgaaggcaacacccgagcgccaa gcgcgcaatcccgccaccggcgcgacgatcaaggtggctgctgcgaagaagctgaccttc ccgcctgcgaaggcgctcaaggacgcaatgaacacctaa

DBGET integrated database retrieval system