Reichenbachiella agarivorans: N6H18_13125 Help Entry N6H18_13125       CDS       T08483                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rek  Reichenbachiella agarivorans Pathway rek00998   Biosynthesis of various antibiotics rek01100   Metabolic pathways rek01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rek00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     N6H18_13125    00074 Mycolic acid biosynthesis     N6H18_13125   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     N6H18_13125 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 DUF1493 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  UXP31291 UniProt:  A0ABY6CL93 LinkDB All DBs Position complement(3115906..3116142) Genome browser AA seq 78 aa AA seqDB search MSDIAQKVKSIIIDKLGVEESEVNAEASFTNDLGADSLDTVELIMEFEKEFNISIPDDQA ENIGTVGQAISYLEANAK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtctgatatagcacaaaaagtaaaatcaattattatcgacaaattaggagtagaggag tctgaagtaaacgcagaagcaagcttcacaaacgatcttggtgctgattcacttgataca gtagagttgatcatggaattcgaaaaagaattcaacatctctattccagacgatcaggct gaaaacatcggaactgttggacaagctatctcttacttggaagcgaacgcaaaataa

DBGET integrated database retrieval system