Rhizobium etli bv. mimosae Mim1: REMIM1_PC00229 Help Entry REMIM1_PC00229    CDS       T02778                                  Name (GenBank) DNA-binding HU-like protein   KO K03530   DNA-binding protein HU-beta Organism rel  Rhizobium etli bv. mimosae Mim1 Brite KEGG Orthology (KO) [BR:rel00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:rel03032]     REMIM1_PC00229    03036 Chromosome and associated proteins [BR:rel03036]     REMIM1_PC00229    03400 DNA repair and recombination proteins [BR:rel03400]     REMIM1_PC00229 DNA replication proteins [BR:rel03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     REMIM1_PC00229 Chromosome and associated proteins [BR:rel03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     REMIM1_PC00229 DNA repair and recombination proteins [BR:rel03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       REMIM1_PC00229 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG SSPI Motif Other DBs NCBI-ProteinID:  AGS24582 LinkDB All DBs Position pRetNIM1c:complement(238101..238379) Genome browser AA seq 92 aa AA seqDB search MTTTNEIADKIASDHGLTKVQGKAIVEAVFAAITDAATSGAETSIPGFGKFKVKDTPERE GRNPSTGAAIKVAAARKLGFQPAKALKDALNT NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaccacgacaaatgaaatcgctgacaagatcgcgtcagaccacggcctgacgaaggtg cagggaaaggcgatcgtcgaagctgtatttgcggcgatcacggacgctgccacctccggc gccgagacgtccattcccggcttcgggaaattcaaggtgaaggataccccggagcgcgaa ggccgcaatccgtcgacgggagcggcgatcaaggttgctgcggcaagaaagctcggcttc cagcctgccaaggctctgaaggacgccttgaacacgtaa

DBGET integrated database retrieval system