Prescottella equi: REQ_32710 Help Entry REQ_32710         CDS       T01352                                  Symbol mrx Name (GenBank) putative mycoredoxin Mrx   KO K18917   mycoredoxin [EC:1.20.4.3] Organism req  Prescottella equi Brite KEGG Orthology (KO) [BR:req00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     REQ_32710 (mrx) Enzymes [BR:req01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      REQ_32710 (mrx) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Glrx-like Thioredoxin GST_N_2 GST_N_3 Thioredoxin_7 Motif Other DBs NCBI-ProteinID:  CBH49269 UniProt:  A0A3S5Y9V8 LinkDB All DBs Position 3477148..3477399 Genome browser AA seq 83 aa AA seqDB search MTTEAPALTMYSTTWCGYCRRLKKQLDENGISYVEIDIELDPASAEFVGSVNGGNHVVPT VKYADGSTATNPSLAQVKQALGL NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtgactaccgaagctcccgccctgaccatgtactcgaccacgtggtgcggttactgccgt cgcctgaagaagcagctcgacgagaacggcatctcgtacgtcgagatcgacatcgagctc gatcccgcgtcggccgagttcgtgggcagcgtcaacggcggcaaccacgtcgtccccacc gtgaagtacgcggacggcagcaccgccaccaatccgagcctggcgcaggtcaagcaggcc ctgggcctctag

DBGET integrated database retrieval system