Rhodococcus erythropolis PR4: RER_22230 Help Entry RER_22230         CDS       T00881                                  Name (GenBank) conserved hypothetical protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism rer  Rhodococcus erythropolis PR4 Brite KEGG Orthology (KO) [BR:rer00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     RER_22230 Enzymes [BR:rer01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      RER_22230 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Glrx-like GST_N_2 Thioredoxin GST_N_3 Motif Other DBs NCBI-ProteinID:  BAH32931 UniProt:  C0ZX46 LinkDB All DBs Position complement(2420979..2421236) Genome browser AA seq 85 aa AA seqDB search MTSTENAPALTIYSTTWCGYCRRLKTQLNASGIEYTEIDIENDPAAADFVGSVNGGNHVV PTVKYGDGSVATNPSLNQVKQALGL NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtgacttctaccgaaaatgcgcctgccctgaccatctactcgaccacgtggtgtggctac tgccgccgcctcaagacgcagctcaacgcgtcggggatcgagtacaccgagatcgacatc gagaacgatccggcagcagccgatttcgtcggcagcgtcaacggtggaaatcacgtcgtt ccgaccgtgaagtacggcgacggcagcgtcgcgaccaacccgtcgctcaaccaggtcaag caggccctgggtctgtag

DBGET integrated database retrieval system